Protein coding transcript 1772

• Transcript: Ll_transcript_417267
• CDS coordinates: 61-438 (+)
• Peptide sequence: MVRTNVLADALKSINNAEKRGKRQVLIRPNSKVIVKFLSVMMKKGYIGEFEVVDDHRAGKIVVNLTGRLNKCGVISPRFDVPIPEIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKIL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_417267

• Blastp: 40S ribosomal protein S15a from Sophophora with 91.27% of identity
• Blastx: 40S ribosomal protein S15a from Sophophora with 91.27% of identity
• Eggnog: One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit (By similarity)(COG0096)
• Kegg: Link to kegg annotations (Dyak_GE16163)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004513036.1)
• Pfam: Ribosomal protein S8 (PF00410.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;