Protein coding transcript 1785

• Transcript: Ll_transcript_389643
• CDS coordinates: 105-560 (+)
• Peptide sequence: MPREKVKLAYINDINARKASFNKRKKCIFKKMSELTILCGIHACAIIQNPFDFQIEVWPNPKGANEVIERYQNTSVIDESKNMNQERFFIQKISKAQQKLHNLRKENHAKEITLAMFEYIQTRKLPENLTIQDLKVMYYMREKFMKEIEKKK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_389643

• Blastp: MADS-box transcription factor PHERES 2 from Arabidopsis with 35.33% of identity
• Blastx: MADS-box transcription factor PHERES 2 from Arabidopsis with 35.33% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT1G65300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430786.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;