Protein coding transcript 1797

• Transcript: Ll_transcript_389631
• CDS coordinates: 43-414 (+)
• Peptide sequence: MIGARLSRALRAGATARPTFQTNAFQRMPALRVQRGYASSGGVKERAVRDALNEAMAEEMERNEKVFVLGEEVAQYNGAYKVTKGLLDRFGDKRVIDSPITESGFCGLTVGAALAGLHPVCEFM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_389631

• Blastp: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial from Schizosaccharomyces with 61.17% of identity
• Blastx: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial from Schizosaccharomyces with 61.17% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC30D10.13c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020996564.1)
• Pfam: Transketolase, pyrimidine binding domain (PF02779.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;