Protein coding transcript 1847

• Transcript: Ll_transcript_491592
• CDS coordinates: 33-350 (+)
• Peptide sequence: MADKLYTSETPSEVKNAKGIHLITMNTPNGQAVQVLLEELKDAYGTEWTTTVIDIMTNEQKKEWFLKLDPNGRIPVIVDNTQNPPFTVMETSAELLYLLKFADKKD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_491592

• Blastp: Disulfide-bond oxidoreductase YghU from Escherichia with 39.51% of identity
• Blastx: Disulfide-bond oxidoreductase YghU from Escherichia with 39.51% of identity
• Eggnog: glutathione Stransferase(COG0625)
• Kegg: Link to kegg annotations (JW5492)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020210473.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF13417.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;