| Transcript | Ll_transcript_534361 |
|---|---|
| CDS coordinates | 33-341 (+) |
| Peptide sequence | MAMEIVVLGRLEKVNLRNIYSKVKILGTLLCVLGAFTMSIMQSISAPATENGTTVKSSSTPSDFIFDKQKIIGCFYLMTSVFILSSSIVLQAFALGGFPAPMS |
| ORF Type | 3prime_partial |
| Blastp | WAT1-related protein At5g47470 from Arabidopsis with 52.69% of identity |
|---|---|
| Blastx | WAT1-related protein At5g47470 from Arabidopsis with 52.69% of identity |
| Eggnog | auxin-induced protein(ENOG410YAMV) |
| Kegg | Link to kegg annotations (AT5G47470) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445054.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer