Protein coding transcript 1897

• Transcript: Ll_transcript_276016
• CDS coordinates: 55-1242 (+)
• Peptide sequence: MFTLRMMMMFSSSSSFFLCLFLFFSVTHVLGDKFFTGTYGVNYGRIADNLPSPHSVVTLLKAAKIRNIRIYDVNQEVLTAFKGSGIQISVCLPNELLKEMSVAEDRAMTWIKENVQPYIPGTKIRGIAIGNEILGSGDVELWEALLPAAKNIYSALNRLGLAHEIQVTSPHSEAVFANSYPPSACTFRDDILPYMKPLLEFFSQNGTPFFINAYPFLAYKNDPQHIDINYALFKKNHGIYDAKTKLHYDNMFDAQVDAAYAALEKVGYDKMEVIVSETGWASHGDDNEAGATVKNAKTYNKNLRKKLLKRKGTPYRPKKVVKAYIFALFNENLKPGPTSERNFGLFKPDGSIAYDIGFTGLVDSSATSSLLNFKVCICLIFALFNTFSSNSDIQSH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276016

• Blastp: Glucan endo-1,3-beta-glucosidase 11 from Arabidopsis with 49.85% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase 11 from Arabidopsis with 48.92% of identity
• Eggnog: glucan endo-1-3-beta-glucosidase(ENOG410YA4N)
• Kegg: Link to kegg annotations (AT1G32860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443370.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;