Protein coding transcript 1926

• Transcript: Ll_transcript_432272
• CDS coordinates: 113-529 (+)
• Peptide sequence: MGSVKLVTRASPCSVINPHYPEIRFKSQIFNPNPNPLLRVPISLKGGKTITKPFSFTVSSSLTNQNTVTVEDAEKKTTFNFKAYVLEKGDIINKALDAAIPLKEPVTIQEAMRYSLLAGGKRVRPMLCIAACELVSGRH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_432272

• Blastp: Geranylgeranyl pyrophosphate synthase, chloroplastic from Capsicum with 60.67% of identity
• Blastx: Geranylgeranyl pyrophosphate synthase, chloroplastic from Capsicum with 60.67% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107867046)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424374.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;