Transcript | Ll_transcript_333668 |
---|---|
CDS coordinates | 2-511 (+) |
Peptide sequence | MGPPDPILGVTEAFKRDQNPNKINLGVGAYRDDNGKPFVLPSVIEAEERMRKKALDKEYAPISGPADFCKHSITLALGDDSEHIKNSLNATVQGISGTGSLRIGGAFLARFFPGSKDLYLPTPSWGNHTPIFKDSGLNVKQYRYYDPATCGFNFQGALDDISKIPEKSII |
ORF Type | 3prime_partial |
Blastp | Aspartate aminotransferase, mitochondrial from Rattus with 68.24% of identity |
---|---|
Blastx | Aspartate aminotransferase, mitochondrial from Rattus with 68.24% of identity |
Eggnog | aminotransferase(COG1448) |
Kegg | Link to kegg annotations (25721) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003544600.1) |
Pfam | Aminotransferase class I and II (PF00155.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer