Protein coding transcript 201

• Transcript: Ll_transcript_333668
• CDS coordinates: 2-511 (+)
• Peptide sequence: MGPPDPILGVTEAFKRDQNPNKINLGVGAYRDDNGKPFVLPSVIEAEERMRKKALDKEYAPISGPADFCKHSITLALGDDSEHIKNSLNATVQGISGTGSLRIGGAFLARFFPGSKDLYLPTPSWGNHTPIFKDSGLNVKQYRYYDPATCGFNFQGALDDISKIPEKSII
• ORF Type: 3prime_partial

Annotations of Ll_transcript_333668

• Blastp: Aspartate aminotransferase, mitochondrial from Rattus with 68.24% of identity
• Blastx: Aspartate aminotransferase, mitochondrial from Rattus with 68.24% of identity
• Eggnog: aminotransferase(COG1448)
• Kegg: Link to kegg annotations (25721)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003544600.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;