Protein coding transcript 208

• Transcript: Ll_transcript_318298
• CDS coordinates: 1-555 (+)
• Peptide sequence: VGADYAKQTMSSATDFILKLFQENTDASDRKSVEEVGLVIENIDGVAFDSNNEIHVSSNFIERFNGDIKAELTGMLYHEMTHVWQWDANGQAPSGLIEGIADFVRLKAGYASNDWVPPGRGEDWFQGYDVTARFLDYCNTIKNGFVAELNKRMKSSYSDTYFVELLGKPVSQLWSDYKAKYAIN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_318298

• Blastp: Basic secretory protease from Boswellia with 48.39% of identity
• Blastx: Basic secretory protease from Boswellia with 48.39% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449590.1)
• Pfam: Peptidase of plants and bacteria (PF04450.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;