Protein coding transcript 216

• Transcript: Ll_transcript_470254
• CDS coordinates: 3-479 (+)
• Peptide sequence: RIPEYFEGKNVYDFIDPEIDSKLAALEEEESRLAEEGYYDEEEELEDADEVDIKYKADLIREKRMLIRNANKMRKSLKNKAIIPRNKKNVDLNTMTEGLEDAGYDTSKIEERARNARSNKAPSRSRAATEDSSAMDVDATAEERLRSKSRVATRTQTSN
• ORF Type: internal

Annotations of Ll_transcript_470254

• Blastp: Nucleolar GTP-binding protein 1 from Chaetomium with 53.95% of identity
• Blastx: Nucleolar GTP-binding protein 1 from Chaetomium with 53.95% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CTHT_0029660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014620011.1)
• Pfam: NOGCT (NUC087) domain (PF08155.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;