Transcript | Ll_transcript_470257 |
---|---|
CDS coordinates | 1-333 (+) |
Peptide sequence | KTSDGYLLTLHRIPNPGKPVVYLQHGLLCSSADWVVLGPEESLAYILFDAGYDVWMGNTRGNTYSRAHATLTPEDDAFWDFSWHEMGIYDIPEMIDFILAKTEQDSLVYIG |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Lipase 3 from Sophophora with 57.26% of identity |
Eggnog | Alpha beta hydrolase(COG0596) |
Kegg | Link to kegg annotations (Dmel_CG8823) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014523679.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer