Protein coding transcript 219

• Transcript: Ll_transcript_352599
• CDS coordinates: 3-401 (+)
• Peptide sequence: KLGADLYVSTDEDKDWAKHNAQTLDLIICTVSSAKMPLDGYLSLLKTHGTFIQVGAPDGGELPPINAFTLLSGGLKVGGSGIGAPWEIKEMLELAAEKKIKPWIQKRPMKDANTAVVDMEAGKARYRYVLEN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_352599

• Blastp: NADP-dependent alcohol dehydrogenase 7 from Saccharomyces with 33.08% of identity
• Blastx: NADP-dependent alcohol dehydrogenase 7 from Saccharomyces with 30.88% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YCR105W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020969759.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;