Protein coding transcript 432

• Transcript: Ll_transcript_421829
• CDS coordinates: 2-706 (+)
• Peptide sequence: NPSLHSLQNLSFKTLNFSVSHHCVTSLNPNPSTPVTSLAVHGHLLYVATGHQITVYENNTFTNLHNFNSQATSSGSTKTITFCNGMIFTTHQDSKIRVWNHTPQKSNLHRMLTTLPTVNDRLRRFLLPKNYVTIRRHNKRLWIEHADAVTGLAVNNVNGVIYSVSWDKTLKIWRVSDLRCLESVKAHDDAVNAVAVSNDGTVYTGSADKRIRVWAKPNNEKRHVLLATLEKHESA
• ORF Type: internal

Annotations of Ll_transcript_421829

• Blastp: Protein JINGUBANG from Arabidopsis with 43.14% of identity
• Blastx: Protein JINGUBANG from Arabidopsis with 43.14% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT2G26490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462824.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;