Transcript | Ll_transcript_376805 |
---|---|
CDS coordinates | 48-401 (+) |
Peptide sequence | MSFAIIFIQDLLFHVFHFLKSKEVSVLSWCSCVLLASSAFLYFMSRPRKIYLVDFACYKPGPACICSKEKFMKMSTCASQVRDESLDFQMRILNGFGLGKHTYWPESLLKIPPSISIA |
ORF Type | 3prime_partial |
Blastp | 3-ketoacyl-CoA synthase 20 from Arabidopsis with 42.42% of identity |
---|---|
Blastx | 3-ketoacyl-CoA synthase 20 from Arabidopsis with 42.42% of identity |
Eggnog | 3-ketoacyl-coa synthase(ENOG410Y5VH) |
Kegg | Link to kegg annotations (AT5G43760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460038.1) |
Pfam | FAE1/Type III polyketide synthase-like protein (PF08392.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer