Protein coding transcript 596

• Transcript: Ll_transcript_376805
• CDS coordinates: 48-401 (+)
• Peptide sequence: MSFAIIFIQDLLFHVFHFLKSKEVSVLSWCSCVLLASSAFLYFMSRPRKIYLVDFACYKPGPACICSKEKFMKMSTCASQVRDESLDFQMRILNGFGLGKHTYWPESLLKIPPSISIA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_376805

• Blastp: 3-ketoacyl-CoA synthase 20 from Arabidopsis with 42.42% of identity
• Blastx: 3-ketoacyl-CoA synthase 20 from Arabidopsis with 42.42% of identity
• Eggnog: 3-ketoacyl-coa synthase(ENOG410Y5VH)
• Kegg: Link to kegg annotations (AT5G43760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460038.1)
• Pfam: FAE1/Type III polyketide synthase-like protein (PF08392.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;