Protein coding transcript 607

• Transcript: Ll_transcript_367369
• CDS coordinates: 250-807 (+)
• Peptide sequence: MPWKSRTGLLGFVLEVAQHLGENVVRTIAMDGTEGLVRGQEVLDSGNPIMIPVGAETLGRIINVIGEPIDERGPIGSKHFAAIHAEAPEFVDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVISLKDKTSKVALVY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_367369

• Blastp: ATP synthase subunit beta, mitochondrial from Bos with 92% of identity
• Blastx: ATP synthase subunit beta, mitochondrial from Bos with 92% of identity
• Eggnog: Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits (By similarity)(COG0055)
• Kegg: Link to kegg annotations (327675)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016175122.1)
• Pfam: ATP synthase alpha/beta family, beta-barrel domain (PF02874.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;