Protein coding transcript 609

• Transcript: Ll_transcript_367374
• CDS coordinates: 2-346 (+)
• Peptide sequence: VDVFSGSSRREEDEEEELKWAAIQKLPTFLRLSRGILTESEGQPSTEIHINKLGSLQRKDLVERLVNIAEEDNEKFLLKLRERIDRVGLDIPTIEVRFEHLNVEAEAHVGSRALP
• ORF Type: internal

Annotations of Ll_transcript_367374

• Blastp: Pleiotropic drug resistance protein 1 from Nicotiana with 64.35% of identity
• Blastx: Pleiotropic drug resistance protein 1 from Nicotiana with 64.35% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107799533)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437694.1)
• Pfam: ABC-transporter extracellular N-terminal (PF14510.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;