| Transcript | Ll_transcript_477691 |
|---|---|
| CDS coordinates | 1-372 (+) |
| Peptide sequence | KLRQLEIEIHALDREKDEGSKARLGEARAEKANIEEDLKPMREKYESEKERAKEIQEQKIKLDQLKTKQQEAERTRDLATASDLKYYAIPDVENRIEVLEREKAAADFEARRGDQGEALVADAV |
| ORF Type | internal |
| Blastp | Heat shock protein 104 from Schizosaccharomyces with 53.97% of identity |
|---|---|
| Blastx | Heat shock protein 104 from Schizosaccharomyces with 53.97% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPBC16D10.08c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_013447976.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer