Protein coding transcript 618

• Transcript: Ll_transcript_468494
• CDS coordinates: 23-583 (+)
• Peptide sequence: MGLPFIGDTLSFLKSPDFMKRRRSVYGNMFKTHALGSHMIVCMDPQINKYLLINEAKLGLTIAYPDSIKNIIGVNMAEVNGTVHKRVRGILLSLIGPAAHRDRLVLKMDKCMRSFLHNWAGKTIDIQQKARQMAFMGSLEQIVQDEPNSFYESFEDLFVKMFSGSMSPLINIPGTKYYQGLKARVKL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_468494

• Blastp: Cytochrome P450 85A1 from Lycopersicon with 48.92% of identity
• Blastx: Cytochrome P450 85A1 from Lycopersicon with 50.26% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (100037489)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459924.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;