| Transcript | Ll_transcript_340505 |
|---|---|
| CDS coordinates | 2-307 (+) |
| Peptide sequence | NAGFGSDKLMLVEGGVQQSWIWKVKEDGMTSTAASAGMLMQWDVEMGLDKIDAFTYVNEDQVKAGAALATGIINSGVRLDGDPAMALLGDLEGKSVAVKVAS |
| ORF Type | internal |
| Blastp | 26S proteasome regulatory subunit rpn-1 from Neurospora with 56.19% of identity |
|---|---|
| Blastx | 26S proteasome regulatory subunit rpn-1 from Neurospora with 56.19% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (NCU07721) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453693.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer