| Transcript | Ll_transcript_452623 |
|---|---|
| CDS coordinates | 1-492 (+) |
| Peptide sequence | VSEKGTWTEDWLSLQPGFLSTEERQQYDDKSSEFRKDMDANIKAADVLDKEFGVFFASAGHAALIDYPHAAQLQEIAAKVWKRGGIVSAVCHGPAIFANLLDPDTKKPIVEGKKITGFTTQAEYDMGIMDGLRAWNEPMIDEHAKALGANYVRSEGVWDDYHVV |
| ORF Type | internal |
| Blastp | Glyoxalase 3 from Candida with 45.68% of identity |
|---|---|
| Blastx | Glyoxalase 3 from Candida with 45.68% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (CAALFM_C302610CA) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017419932.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer