Protein coding transcript 658

• Transcript: Ll_transcript_347203
• CDS coordinates: 2-460 (+)
• Peptide sequence: SEYQEKSAKLQAQKADLESQLTDVQERLQQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELNLQKSEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKLQGETNQKTGEELQAAEDKVNHLNKVKVKLEQTLDELEDSLEREKKLRGDVEKA
• ORF Type: internal

Annotations of Ll_transcript_347203

• Blastp: Myosin heavy chain, muscle from Sophophora with 86.18% of identity
• Blastx: Myosin heavy chain, muscle from Sophophora with 86.18% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (Dmel_CG17927)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003595922.2)
• Pfam: Myosin tail (PF01576.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;