Protein coding transcript 660

• Transcript: Ll_transcript_347208
• CDS coordinates: 1-495 (+)
• Peptide sequence: LILVKKKDGGWRFCVDYRALNNITVPNKFPIPIIELLDELGGATLFSKLDLKSGYYQIRMKEEDIPKTAFRTREGHYEYMVMSFGLTNAPSTFQALMNDVFRPFLRKFVLVFFDDILVYSHDMAAHCTHLERVFRILWENQLWVNFKKCCFGAGKLEYLGHIISG
• ORF Type: internal

Annotations of Ll_transcript_347208

• Blastp: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 43.45% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 43.45% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459981.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;