Protein coding transcript 665

• Transcript: Ll_transcript_477642
• CDS coordinates: 1-351 (+)
• Peptide sequence: TKDVLQPGSEVVAAGYCLYGSATMMVLSFGQGVNGFMLDPAIGEFVLTEKNMRVPEQGKIYSINEGYTYLWDEAIKEYVRQKKDPACGKPYGARYVGSMVADVHRTLKYGGIFMYPA
• ORF Type: internal

Annotations of Ll_transcript_477642

• Blastp: Fructose-1,6-bisphosphatase isozyme 2 from Mus with 69.23% of identity
• Blastx: Fructose-1,6-bisphosphatase isozyme 2 from Mus with 69.23% of identity
• Eggnog: D-fructose-1,6-bisphosphate 1-phosphohydrolase class 1(COG0158)
• Kegg: Link to kegg annotations (14120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003593121.1)
• Pfam: Fructose-1-6-bisphosphatase, N-terminal domain (PF00316.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;