Transcript | Ll_transcript_458832 |
---|---|
CDS coordinates | 2-553 (+) |
Peptide sequence | YNKFAGFLPDNKLFRQLSLRDLAGNQGLCTSGQDSCFVYGSGKKGMALNESGVRKSRMLKLTIGLLITLTVIMVVMGITAVIKARRGIRDDDSELGGDSWSWQFIPFQKLNFSVDQVLRCLVDINVIGKGCSGVVYRAEMDNGEVIAVKKLWPITTEAGEAFKEEKSGVRDSFSTEVKTLGSIR |
ORF Type | internal |
Blastp | LRR receptor-like serine/threonine-protein kinase RCH1 from Arabidopsis with 57.84% of identity |
---|---|
Blastx | Receptor-like protein kinase 2 from Arabidopsis with 62.37% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT5G48940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428632.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer