Transcript | Ll_transcript_321641 |
---|---|
CDS coordinates | 50-481 (+) |
Peptide sequence | MVAFFIPSHSLSLVLALMLFFTNITVQSQQINATDFSCPVDSPPSCETYMTYIAHSPNFLSVVSISNIFDTSPLSIARASNLDAEDNTLIPNQVLLVPVTCSCIGNRSFANISYEIKLGDTYQFVVETIYENLTNWLVVADLNP |
ORF Type | 3prime_partial |
Blastp | Serine/threonine receptor-like kinase NFP from Medicago with 60.69% of identity |
---|---|
Blastx | Serine/threonine receptor-like kinase NFP from Medicago with 60.69% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_5g019040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420412.1) |
Pfam | LysM domain (PF01476.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer